Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376

  1. Avatar for BurtHarris 101. BurtHarris Lv 1 1 pt. 9,422
  2. Avatar for aendgraend 102. aendgraend Lv 1 1 pt. 9,413
  3. Avatar for _Cyber_ 103. _Cyber_ Lv 1 1 pt. 9,388
  4. Avatar for SiliconDioxide 104. SiliconDioxide Lv 1 1 pt. 9,360
  5. Avatar for harvardman 105. harvardman Lv 1 1 pt. 9,347
  6. Avatar for Bithalbierer 106. Bithalbierer Lv 1 1 pt. 9,344
  7. Avatar for perfideas 107. perfideas Lv 1 1 pt. 9,315
  8. Avatar for abda bdu 109. abda bdu Lv 1 1 pt. 9,266
  9. Avatar for katiekt94 110. katiekt94 Lv 1 1 pt. 9,260

Comments