Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for IB Bio 18. IB Bio 1 pt. 4,734

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 68 pts. 10,553
  2. Avatar for phi16 12. phi16 Lv 1 65 pts. 10,533
  3. Avatar for RockOn 13. RockOn Lv 1 63 pts. 10,525
  4. Avatar for O Seki To 14. O Seki To Lv 1 60 pts. 10,514
  5. Avatar for 181818 15. 181818 Lv 1 58 pts. 10,506
  6. Avatar for TastyMunchies 16. TastyMunchies Lv 1 55 pts. 10,495
  7. Avatar for silent gene 17. silent gene Lv 1 53 pts. 10,494
  8. Avatar for MicElephant 18. MicElephant Lv 1 51 pts. 10,490
  9. Avatar for jobo0502 19. jobo0502 Lv 1 49 pts. 10,484
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 46 pts. 10,461

Comments