Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 68 pts. 10,553
  2. Avatar for phi16 12. phi16 Lv 1 65 pts. 10,533
  3. Avatar for RockOn 13. RockOn Lv 1 63 pts. 10,525
  4. Avatar for O Seki To 14. O Seki To Lv 1 60 pts. 10,514
  5. Avatar for 181818 15. 181818 Lv 1 58 pts. 10,506
  6. Avatar for TastyMunchies 16. TastyMunchies Lv 1 55 pts. 10,495
  7. Avatar for silent gene 17. silent gene Lv 1 53 pts. 10,494
  8. Avatar for MicElephant 18. MicElephant Lv 1 51 pts. 10,490
  9. Avatar for jobo0502 19. jobo0502 Lv 1 49 pts. 10,484
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 46 pts. 10,461

Comments