Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,344
  8. Avatar for IB Bio 18. IB Bio 1 pt. 4,734
  1. Avatar for robgee 31. robgee Lv 1 28 pts. 10,387
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 27 pts. 10,386
  3. Avatar for alcor29 33. alcor29 Lv 1 25 pts. 10,382
  4. Avatar for georg137 34. georg137 Lv 1 24 pts. 10,380
  5. Avatar for vakobo 35. vakobo Lv 1 23 pts. 10,376
  6. Avatar for Vinara 36. Vinara Lv 1 22 pts. 10,352
  7. Avatar for DoctorSockrates 37. DoctorSockrates Lv 1 21 pts. 10,351
  8. Avatar for pvc78 38. pvc78 Lv 1 20 pts. 10,350
  9. Avatar for Idiotboy 39. Idiotboy Lv 1 19 pts. 10,349
  10. Avatar for drumpeter18yrs9yrs 40. drumpeter18yrs9yrs Lv 1 18 pts. 10,349

Comments