1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Summary

• Created: November 26, 2019
• Expires: December 04, 2019 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 1. Beta Folders 100 pts. 10,819
• 2. Go Science 74 pts. 10,782
• 3. Gargleblasters 54 pts. 10,721
• 4. L'Alliance Francophone 38 pts. 10,606
• 5. Anthropic Dreams 27 pts. 10,557
• 6. HMT heritage 18 pts. 10,514
• 7. Void Crushers 12 pts. 10,446
• 8. Marvin's bunch 8 pts. 10,420
• 9. Contenders 5 pts. 10,380
• 10. Russian team 3 pts. 10,376

Top soloists

• 31. robgee 28 pts. 10,387
• 32. christioanchauvin 27 pts. 10,386
• 33. alcor29 25 pts. 10,382
• 34. georg137 24 pts. 10,380
• 35. vakobo 23 pts. 10,376
• 36. Vinara 22 pts. 10,352
• 37. DoctorSockrates 21 pts. 10,351
• 38. pvc78 20 pts. 10,350
• 39. Idiotboy 19 pts. 10,349
• 40. drumpeter18yrs9yrs 18 pts. 10,349