Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376
  1. Avatar for Deleted player 121. Deleted player pts. 8,708
  2. Avatar for julianafelipa 122. julianafelipa Lv 1 1 pt. 8,297
  3. Avatar for henrygi 123. henrygi Lv 1 1 pt. 8,254
  4. Avatar for Kartoxa 124. Kartoxa Lv 1 1 pt. 7,940
  5. Avatar for Reuben_Allen 125. Reuben_Allen Lv 1 1 pt. 7,909
  6. Avatar for Kucci 126. Kucci Lv 1 1 pt. 6,654
  7. Avatar for gurch 127. gurch Lv 1 1 pt. 4,734
  8. Avatar for Gregor_Walk 128. Gregor_Walk Lv 1 1 pt. 4,734
  9. Avatar for EvgeniaCh 129. EvgeniaCh Lv 1 1 pt. 4,734
  10. Avatar for AriannaRodriguezNobles19 130. AriannaRodriguezNobles19 Lv 1 1 pt. 4,734

Comments