Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376
  1. Avatar for mbastion 111. mbastion Lv 1 1 pt. 9,257
  2. Avatar for Old Chap 112. Old Chap Lv 1 1 pt. 9,242
  3. Avatar for Belle36 113. Belle36 Lv 1 1 pt. 9,207
  4. Avatar for Very_Lazy 114. Very_Lazy Lv 1 1 pt. 9,163
  5. Avatar for kotenok2000 115. kotenok2000 Lv 1 1 pt. 9,104
  6. Avatar for Proteins4Life1 116. Proteins4Life1 Lv 1 1 pt. 9,096
  7. Avatar for dahast.de 117. dahast.de Lv 1 1 pt. 9,077
  8. Avatar for marcramossala 118. marcramossala Lv 1 1 pt. 8,912
  9. Avatar for petetrig 119. petetrig Lv 1 1 pt. 8,791
  10. Avatar for Silent_Strike 120. Silent_Strike Lv 1 1 pt. 8,742

Comments