Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 17 pts. 10,343
  2. Avatar for joremen 42. joremen Lv 1 16 pts. 10,338
  3. Avatar for Deleted player 43. Deleted player pts. 10,270
  4. Avatar for Blipperman 44. Blipperman Lv 1 14 pts. 10,270
  5. Avatar for Merf 45. Merf Lv 1 14 pts. 10,266
  6. Avatar for Threeoak 46. Threeoak Lv 1 13 pts. 10,238
  7. Avatar for jausmh 47. jausmh Lv 1 12 pts. 10,220
  8. Avatar for johngran 48. johngran Lv 1 12 pts. 10,220
  9. Avatar for rezaefar 49. rezaefar Lv 1 11 pts. 10,210
  10. Avatar for jamiexq 50. jamiexq Lv 1 10 pts. 10,203

Comments