Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Void Crushers 100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 8 pts. 9,060
  2. Avatar for wosser1 62. wosser1 Lv 1 8 pts. 9,006
  3. Avatar for Amphimixus 63. Amphimixus Lv 1 7 pts. 9,003
  4. Avatar for Hellcat6 64. Hellcat6 Lv 1 7 pts. 8,990
  5. Avatar for pfirth 65. pfirth Lv 1 6 pts. 8,965
  6. Avatar for fpc 66. fpc Lv 1 6 pts. 8,964
  7. Avatar for boondog 67. boondog Lv 1 6 pts. 8,952
  8. Avatar for Steven Pletsch 68. Steven Pletsch Lv 1 5 pts. 8,950
  9. Avatar for cobaltteal 69. cobaltteal Lv 1 5 pts. 8,937
  10. Avatar for edpalas 70. edpalas Lv 1 5 pts. 8,916

Comments