Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for JasperD 81. JasperD Lv 1 26 pts. 9,912
  2. Avatar for mopbag 82. mopbag Lv 1 25 pts. 9,900
  3. Avatar for pfirth 83. pfirth Lv 1 25 pts. 9,891
  4. Avatar for 20x48 84. 20x48 Lv 1 24 pts. 9,873
  5. Avatar for pmlkjn 85. pmlkjn Lv 1 24 pts. 9,871
  6. Avatar for alwen 86. alwen Lv 1 24 pts. 9,854
  7. Avatar for Greg60 87. Greg60 Lv 1 23 pts. 9,844
  8. Avatar for jsfoldingaccount 88. jsfoldingaccount Lv 1 23 pts. 9,843
  9. Avatar for Migi 89. Migi Lv 1 22 pts. 9,831
  10. Avatar for p66 90. p66 Lv 1 22 pts. 9,830

Comments