Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for sciencewalker 111. sciencewalker Lv 1 9 pts. 9,930
  2. Avatar for MnSk 112. MnSk Lv 1 9 pts. 9,898
  3. Avatar for backterria 113. backterria Lv 1 9 pts. 9,887
  4. Avatar for Deleted player 114. Deleted player pts. 9,886
  5. Avatar for Pibeagles1 115. Pibeagles1 Lv 1 8 pts. 9,859
  6. Avatar for edpalas 116. edpalas Lv 1 8 pts. 9,849
  7. Avatar for Bucsan 117. Bucsan Lv 1 8 pts. 9,841
  8. Avatar for NPrincipi 118. NPrincipi Lv 1 7 pts. 9,826
  9. Avatar for gldisater 119. gldisater Lv 1 7 pts. 9,823
  10. Avatar for badgoes 120. badgoes Lv 1 7 pts. 9,821

Comments