Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for neon_fuzz 71. neon_fuzz Lv 1 25 pts. 10,472
  2. Avatar for Polarstern 72. Polarstern Lv 1 24 pts. 10,463
  3. Avatar for ShadowTactics 73. ShadowTactics Lv 1 24 pts. 10,448
  4. Avatar for Tygh 74. Tygh Lv 1 23 pts. 10,439
  5. Avatar for Blue102 75. Blue102 Lv 1 22 pts. 10,430
  6. Avatar for Merf 76. Merf Lv 1 22 pts. 10,429
  7. Avatar for Threeoak 77. Threeoak Lv 1 21 pts. 10,424
  8. Avatar for tangofox10 78. tangofox10 Lv 1 21 pts. 10,415
  9. Avatar for versat82 79. versat82 Lv 1 20 pts. 10,412
  10. Avatar for allie_heather47 80. allie_heather47 Lv 1 20 pts. 10,410

Comments