Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739
  1. Avatar for Vincera 131. Vincera Lv 1 1 pt. 8,646
  2. Avatar for rezaefar 132. rezaefar Lv 1 1 pt. 8,620
  3. Avatar for xabxs 133. xabxs Lv 1 1 pt. 8,594
  4. Avatar for rinze 134. rinze Lv 1 1 pt. 8,591
  5. Avatar for Keresto 135. Keresto Lv 1 1 pt. 8,585
  6. Avatar for kvasirthewise 136. kvasirthewise Lv 1 1 pt. 8,523
  7. Avatar for sciencewalker 137. sciencewalker Lv 1 1 pt. 8,514
  8. Avatar for Alec_C 138. Alec_C Lv 1 1 pt. 8,489
  9. Avatar for Philzord 139. Philzord Lv 1 1 pt. 8,391
  10. Avatar for kitek314_pl 140. kitek314_pl Lv 1 1 pt. 8,351

Comments