Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739
  1. Avatar for jsfoldingaccount 111. jsfoldingaccount Lv 1 2 pts. 8,947
  2. Avatar for Formula350 112. Formula350 Lv 1 2 pts. 8,931
  3. Avatar for rabamino12358 113. rabamino12358 Lv 1 2 pts. 8,924
  4. Avatar for Ashrai 114. Ashrai Lv 1 2 pts. 8,895
  5. Avatar for Czim 115. Czim Lv 1 1 pt. 8,859
  6. Avatar for Beany 116. Beany Lv 1 1 pt. 8,836
  7. Avatar for NeLikomSheet 117. NeLikomSheet Lv 1 1 pt. 8,826
  8. Avatar for 201512809 118. 201512809 Lv 1 1 pt. 8,823
  9. Avatar for dfonda 119. dfonda Lv 1 1 pt. 8,821
  10. Avatar for Evica 120. Evica Lv 1 1 pt. 8,815

Comments