Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739
  1. Avatar for DScott 151. DScott Lv 1 1 pt. 8,040
  2. Avatar for Bearpaw 152. Bearpaw Lv 1 1 pt. 7,988
  3. Avatar for JoshNZ666 153. JoshNZ666 Lv 1 1 pt. 7,958
  4. Avatar for mwm64 154. mwm64 Lv 1 1 pt. 7,917
  5. Avatar for Dr.Sillem 155. Dr.Sillem Lv 1 1 pt. 7,917
  6. Avatar for foobar23 156. foobar23 Lv 1 1 pt. 7,913
  7. Avatar for zannipietro 157. zannipietro Lv 1 1 pt. 7,881
  8. Avatar for roman madala 158. roman madala Lv 1 1 pt. 7,858
  9. Avatar for GuR0 159. GuR0 Lv 1 1 pt. 7,820
  10. Avatar for Mohoernchen 160. Mohoernchen Lv 1 1 pt. 7,795

Comments