Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for Bucsan 161. Bucsan Lv 1 1 pt. 9,187
  2. Avatar for evifnoskcaj 162. evifnoskcaj Lv 1 1 pt. 9,168
  3. Avatar for SEF830 163. SEF830 Lv 1 1 pt. 9,153
  4. Avatar for hada 164. hada Lv 1 1 pt. 9,094
  5. Avatar for bcre8tvv 165. bcre8tvv Lv 1 1 pt. 9,083
  6. Avatar for jamiexq 166. jamiexq Lv 1 1 pt. 9,081
  7. Avatar for sitlux 167. sitlux Lv 1 1 pt. 9,072
  8. Avatar for kwsui 168. kwsui Lv 1 1 pt. 9,048
  9. Avatar for rene1010 169. rene1010 Lv 1 1 pt. 9,044
  10. Avatar for Nolle 170. Nolle Lv 1 1 pt. 9,036

Comments