Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610
  1. Avatar for PlatyParty 181. PlatyParty Lv 1 1 pt. 8,809
  2. Avatar for alextam 182. alextam Lv 1 1 pt. 8,782
  3. Avatar for HMK 183. HMK Lv 1 1 pt. 8,706
  4. Avatar for pmlkjn 184. pmlkjn Lv 1 1 pt. 8,696
  5. Avatar for StAm1984 185. StAm1984 Lv 1 1 pt. 8,498
  6. Avatar for 9racoon 186. 9racoon Lv 1 1 pt. 8,460
  7. Avatar for hwider 187. hwider Lv 1 1 pt. 8,443
  8. Avatar for thearceus 188. thearceus Lv 1 1 pt. 8,412
  9. Avatar for joshmiller 189. joshmiller Lv 1 1 pt. 8,372
  10. Avatar for harvardman 190. harvardman Lv 1 1 pt. 8,368

Comments