Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610
  1. Avatar for rosomaxa12 171. rosomaxa12 Lv 1 1 pt. 9,024
  2. Avatar for pattyloof 172. pattyloof Lv 1 1 pt. 9,002
  3. Avatar for Jenot96 173. Jenot96 Lv 1 1 pt. 8,996
  4. Avatar for Giparang 174. Giparang Lv 1 1 pt. 8,966
  5. Avatar for Auntecedent 175. Auntecedent Lv 1 1 pt. 8,965
  6. Avatar for alyssa_d_V2.0 176. alyssa_d_V2.0 Lv 1 1 pt. 8,907
  7. Avatar for yeldarbkram 177. yeldarbkram Lv 1 1 pt. 8,878
  8. Avatar for deathbat_87 178. deathbat_87 Lv 1 1 pt. 8,878
  9. Avatar for kf24 179. kf24 Lv 1 1 pt. 8,868
  10. Avatar for Pickering 180. Pickering Lv 1 1 pt. 8,810

Comments