Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for amenephus 121. amenephus Lv 1 1 pt. 10,477
  2. Avatar for adessus 122. adessus Lv 1 1 pt. 10,471
  3. Avatar for maitree 123. maitree Lv 1 1 pt. 10,461
  4. Avatar for Yupa 124. Yupa Lv 1 1 pt. 10,443
  5. Avatar for dldahlen 125. dldahlen Lv 1 1 pt. 10,426
  6. Avatar for MariFer 126. MariFer Lv 1 1 pt. 10,408
  7. Avatar for spdenne 127. spdenne Lv 1 1 pt. 10,355
  8. Avatar for HMK 128. HMK Lv 1 1 pt. 10,315
  9. Avatar for hajtogato 129. hajtogato Lv 1 1 pt. 10,301
  10. Avatar for Swapper242 130. Swapper242 Lv 1 1 pt. 10,295

Comments