Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for amenephus 121. amenephus Lv 1 1 pt. 10,477
  2. Avatar for adessus 122. adessus Lv 1 1 pt. 10,471
  3. Avatar for maitree 123. maitree Lv 1 1 pt. 10,461
  4. Avatar for Yupa 124. Yupa Lv 1 1 pt. 10,443
  5. Avatar for dldahlen 125. dldahlen Lv 1 1 pt. 10,426
  6. Avatar for MariFer 126. MariFer Lv 1 1 pt. 10,408
  7. Avatar for spdenne 127. spdenne Lv 1 1 pt. 10,355
  8. Avatar for HMK 128. HMK Lv 1 1 pt. 10,315
  9. Avatar for hajtogato 129. hajtogato Lv 1 1 pt. 10,301
  10. Avatar for Swapper242 130. Swapper242 Lv 1 1 pt. 10,295

Comments