Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for sanguine.st 131. sanguine.st Lv 1 1 pt. 10,284
  2. Avatar for harvardman 132. harvardman Lv 1 1 pt. 10,195
  3. Avatar for 81189h 133. 81189h Lv 1 1 pt. 9,959
  4. Avatar for zo3xiaJonWeinberg 134. zo3xiaJonWeinberg Lv 1 1 pt. 9,937
  5. Avatar for sblee418 135. sblee418 Lv 1 1 pt. 9,540
  6. Avatar for SEF830 136. SEF830 Lv 1 1 pt. 9,136
  7. Avatar for JaneShepard 137. JaneShepard Lv 1 1 pt. 9,129
  8. Avatar for Raham 138. Raham Lv 1 1 pt. 9,005
  9. Avatar for evrimelcin 139. evrimelcin Lv 1 1 pt. 8,388
  10. Avatar for Loris023 140. Loris023 Lv 1 1 pt. 8,312

Comments