Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for sanguine.st 131. sanguine.st Lv 1 1 pt. 10,284
  2. Avatar for harvardman 132. harvardman Lv 1 1 pt. 10,195
  3. Avatar for 81189h 133. 81189h Lv 1 1 pt. 9,959
  4. Avatar for zo3xiaJonWeinberg 134. zo3xiaJonWeinberg Lv 1 1 pt. 9,937
  5. Avatar for sblee418 135. sblee418 Lv 1 1 pt. 9,540
  6. Avatar for SEF830 136. SEF830 Lv 1 1 pt. 9,136
  7. Avatar for JaneShepard 137. JaneShepard Lv 1 1 pt. 9,129
  8. Avatar for Raham 138. Raham Lv 1 1 pt. 9,005
  9. Avatar for evrimelcin 139. evrimelcin Lv 1 1 pt. 8,388
  10. Avatar for Loris023 140. Loris023 Lv 1 1 pt. 8,312

Comments