Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for tcampion 141. tcampion Lv 1 1 pt. 7,190
  2. Avatar for jflat06 142. jflat06 Lv 1 1 pt. 7,013
  3. Avatar for buggo 143. buggo Lv 1 1 pt. 6,925
  4. Avatar for mwm64 144. mwm64 Lv 1 1 pt. 6,898
  5. Avatar for VecchiAsia 145. VecchiAsia Lv 1 1 pt. 6,897
  6. Avatar for DanielS11337 146. DanielS11337 Lv 1 1 pt. 6,897
  7. Avatar for Tagelmust 147. Tagelmust Lv 1 1 pt. 6,897
  8. Avatar for JessicaFernandes_44838603 148. JessicaFernandes_44838603 Lv 1 1 pt. 6,897
  9. Avatar for puxatudo 149. puxatudo Lv 1 1 pt. 6,897
  10. Avatar for heyubob 150. heyubob Lv 1 1 pt. 6,897

Comments