Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for tcampion 141. tcampion Lv 1 1 pt. 7,190
  2. Avatar for jflat06 142. jflat06 Lv 1 1 pt. 7,013
  3. Avatar for buggo 143. buggo Lv 1 1 pt. 6,925
  4. Avatar for mwm64 144. mwm64 Lv 1 1 pt. 6,898
  5. Avatar for VecchiAsia 145. VecchiAsia Lv 1 1 pt. 6,897
  6. Avatar for DanielS11337 146. DanielS11337 Lv 1 1 pt. 6,897
  7. Avatar for Tagelmust 147. Tagelmust Lv 1 1 pt. 6,897
  8. Avatar for puxatudo 149. puxatudo Lv 1 1 pt. 6,897
  9. Avatar for heyubob 150. heyubob Lv 1 1 pt. 6,897

Comments