Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for Steven Pletsch 11. Steven Pletsch Lv 1 71 pts. 12,326
  2. Avatar for Formula350 12. Formula350 Lv 1 69 pts. 12,310
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 66 pts. 12,268
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 64 pts. 12,260
  5. Avatar for Galaxie 15. Galaxie Lv 1 62 pts. 12,245
  6. Avatar for georg137 16. georg137 Lv 1 59 pts. 12,239
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 57 pts. 12,224
  8. Avatar for Phyx 18. Phyx Lv 1 55 pts. 12,209
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 53 pts. 12,184
  10. Avatar for phi16 20. phi16 Lv 1 51 pts. 12,183

Comments