Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for Steven Pletsch 11. Steven Pletsch Lv 1 71 pts. 12,326
  2. Avatar for Formula350 12. Formula350 Lv 1 69 pts. 12,310
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 66 pts. 12,268
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 64 pts. 12,260
  5. Avatar for Galaxie 15. Galaxie Lv 1 62 pts. 12,245
  6. Avatar for georg137 16. georg137 Lv 1 59 pts. 12,239
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 57 pts. 12,224
  8. Avatar for Phyx 18. Phyx Lv 1 55 pts. 12,209
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 53 pts. 12,184
  10. Avatar for phi16 20. phi16 Lv 1 51 pts. 12,183

Comments