Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403
  1. Avatar for Steven Pletsch 11. Steven Pletsch Lv 1 71 pts. 12,326
  2. Avatar for Formula350 12. Formula350 Lv 1 69 pts. 12,310
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 66 pts. 12,268
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 64 pts. 12,260
  5. Avatar for Galaxie 15. Galaxie Lv 1 62 pts. 12,245
  6. Avatar for georg137 16. georg137 Lv 1 59 pts. 12,239
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 57 pts. 12,224
  8. Avatar for Phyx 18. Phyx Lv 1 55 pts. 12,209
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 53 pts. 12,184
  10. Avatar for phi16 20. phi16 Lv 1 51 pts. 12,183

Comments