Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 49 pts. 12,158
  2. Avatar for guineapig 22. guineapig Lv 1 47 pts. 12,155
  3. Avatar for jobo0502 23. jobo0502 Lv 1 45 pts. 12,152
  4. Avatar for aznarog 24. aznarog Lv 1 44 pts. 12,152
  5. Avatar for Deleted player 25. Deleted player 42 pts. 12,133
  6. Avatar for drjr 26. drjr Lv 1 40 pts. 12,126
  7. Avatar for OWM3 27. OWM3 Lv 1 39 pts. 12,098
  8. Avatar for TastyMunchies 28. TastyMunchies Lv 1 37 pts. 12,084
  9. Avatar for spmm 29. spmm Lv 1 36 pts. 12,064
  10. Avatar for ichwilldiesennamen 30. ichwilldiesennamen Lv 1 34 pts. 12,023

Comments