Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 49 pts. 12,158
  2. Avatar for guineapig 22. guineapig Lv 1 47 pts. 12,155
  3. Avatar for jobo0502 23. jobo0502 Lv 1 45 pts. 12,152
  4. Avatar for aznarog 24. aznarog Lv 1 44 pts. 12,152
  5. Avatar for Deleted player 25. Deleted player 42 pts. 12,133
  6. Avatar for drjr 26. drjr Lv 1 40 pts. 12,126
  7. Avatar for OWM3 27. OWM3 Lv 1 39 pts. 12,098
  8. Avatar for TastyMunchies 28. TastyMunchies Lv 1 37 pts. 12,084
  9. Avatar for spmm 29. spmm Lv 1 36 pts. 12,064
  10. Avatar for ichwilldiesennamen 30. ichwilldiesennamen Lv 1 34 pts. 12,023

Comments