Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for robgee 31. robgee Lv 1 33 pts. 11,993
  2. Avatar for johnmitch 32. johnmitch Lv 1 32 pts. 11,972
  3. Avatar for BootsMcGraw 33. BootsMcGraw Lv 1 30 pts. 11,966
  4. Avatar for KarenCH 34. KarenCH Lv 1 29 pts. 11,938
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 28 pts. 11,923
  6. Avatar for John McLeod 36. John McLeod Lv 1 27 pts. 11,916
  7. Avatar for Blipperman 37. Blipperman Lv 1 26 pts. 11,890
  8. Avatar for Visok 38. Visok Lv 1 24 pts. 11,846
  9. Avatar for pvc78 39. pvc78 Lv 1 23 pts. 11,822
  10. Avatar for fpc 40. fpc Lv 1 22 pts. 11,819

Comments