Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403
  1. Avatar for robgee 31. robgee Lv 1 33 pts. 11,993
  2. Avatar for johnmitch 32. johnmitch Lv 1 32 pts. 11,972
  3. Avatar for BootsMcGraw 33. BootsMcGraw Lv 1 30 pts. 11,966
  4. Avatar for KarenCH 34. KarenCH Lv 1 29 pts. 11,938
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 28 pts. 11,923
  6. Avatar for John McLeod 36. John McLeod Lv 1 27 pts. 11,916
  7. Avatar for Blipperman 37. Blipperman Lv 1 26 pts. 11,890
  8. Avatar for Visok 38. Visok Lv 1 24 pts. 11,846
  9. Avatar for pvc78 39. pvc78 Lv 1 23 pts. 11,822
  10. Avatar for fpc 40. fpc Lv 1 22 pts. 11,819

Comments