Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for Superphosphate 41. Superphosphate Lv 1 21 pts. 11,802
  2. Avatar for nicobul 42. nicobul Lv 1 21 pts. 11,796
  3. Avatar for Lotus23 43. Lotus23 Lv 1 20 pts. 11,776
  4. Avatar for MrZanav 44. MrZanav Lv 1 19 pts. 11,750
  5. Avatar for RockOn 45. RockOn Lv 1 18 pts. 11,750
  6. Avatar for Enzyme 46. Enzyme Lv 1 17 pts. 11,700
  7. Avatar for heather-1 47. heather-1 Lv 1 16 pts. 11,641
  8. Avatar for Pazithi 48. Pazithi Lv 1 16 pts. 11,632
  9. Avatar for CharlieFortsConscience 49. CharlieFortsConscience Lv 1 15 pts. 11,597
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 14 pts. 11,592

Comments