Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for Superphosphate 41. Superphosphate Lv 1 21 pts. 11,802
  2. Avatar for nicobul 42. nicobul Lv 1 21 pts. 11,796
  3. Avatar for Lotus23 43. Lotus23 Lv 1 20 pts. 11,776
  4. Avatar for MrZanav 44. MrZanav Lv 1 19 pts. 11,750
  5. Avatar for RockOn 45. RockOn Lv 1 18 pts. 11,750
  6. Avatar for Enzyme 46. Enzyme Lv 1 17 pts. 11,700
  7. Avatar for heather-1 47. heather-1 Lv 1 16 pts. 11,641
  8. Avatar for Pazithi 48. Pazithi Lv 1 16 pts. 11,632
  9. Avatar for WBarme1234 50. WBarme1234 Lv 1 14 pts. 11,592

Comments