Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for pfirth 71. pfirth Lv 1 5 pts. 11,205
  2. Avatar for Dhalion 72. Dhalion Lv 1 4 pts. 11,205
  3. Avatar for hansvandenhof 73. hansvandenhof Lv 1 4 pts. 11,200
  4. Avatar for Pawel Tluscik 74. Pawel Tluscik Lv 1 4 pts. 11,184
  5. Avatar for Psych0Active 75. Psych0Active Lv 1 4 pts. 11,183
  6. Avatar for Anfinsen_slept_here 76. Anfinsen_slept_here Lv 1 4 pts. 11,174
  7. Avatar for donuts554 77. donuts554 Lv 1 3 pts. 11,174
  8. Avatar for fishercat 78. fishercat Lv 1 3 pts. 11,169
  9. Avatar for jausmh 79. jausmh Lv 1 3 pts. 11,161
  10. Avatar for alwen 80. alwen Lv 1 3 pts. 11,155

Comments