Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403
  1. Avatar for pfirth 71. pfirth Lv 1 5 pts. 11,205
  2. Avatar for Dhalion 72. Dhalion Lv 1 4 pts. 11,205
  3. Avatar for hansvandenhof 73. hansvandenhof Lv 1 4 pts. 11,200
  4. Avatar for Pawel Tluscik 74. Pawel Tluscik Lv 1 4 pts. 11,184
  5. Avatar for Psych0Active 75. Psych0Active Lv 1 4 pts. 11,183
  6. Avatar for Anfinsen_slept_here 76. Anfinsen_slept_here Lv 1 4 pts. 11,174
  7. Avatar for donuts554 77. donuts554 Lv 1 3 pts. 11,174
  8. Avatar for fishercat 78. fishercat Lv 1 3 pts. 11,169
  9. Avatar for jausmh 79. jausmh Lv 1 3 pts. 11,161
  10. Avatar for alwen 80. alwen Lv 1 3 pts. 11,155

Comments