Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for hantao 131. hantao Lv 1 1 pt. 9,785
  2. Avatar for roman madala 132. roman madala Lv 1 1 pt. 9,768
  3. Avatar for Sammy3c2b1a0 133. Sammy3c2b1a0 Lv 1 1 pt. 9,761
  4. Avatar for ArikLeer 134. ArikLeer Lv 1 1 pt. 9,755
  5. Avatar for rene1010 135. rene1010 Lv 1 1 pt. 9,740
  6. Avatar for fishercat 136. fishercat Lv 1 1 pt. 9,676
  7. Avatar for Sunmurder 137. Sunmurder Lv 1 1 pt. 9,647
  8. Avatar for booboonuu 138. booboonuu Lv 1 1 pt. 9,616
  9. Avatar for Auntecedent 139. Auntecedent Lv 1 1 pt. 9,597
  10. Avatar for Fartemis 140. Fartemis Lv 1 1 pt. 9,407

Comments