Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for Tygh 21. Tygh Lv 1 49 pts. 12,135
  2. Avatar for Formula350 22. Formula350 Lv 1 47 pts. 12,116
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 45 pts. 12,055
  4. Avatar for jausmh 24. jausmh Lv 1 44 pts. 12,040
  5. Avatar for Deleted player 25. Deleted player 42 pts. 12,036
  6. Avatar for KarenCH 26. KarenCH Lv 1 40 pts. 12,031
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 39 pts. 12,024
  8. Avatar for OWM3 28. OWM3 Lv 1 37 pts. 12,003
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 36 pts. 11,939
  10. Avatar for TastyMunchies 30. TastyMunchies Lv 1 34 pts. 11,925

Comments