Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for Tygh 21. Tygh Lv 1 49 pts. 12,135
  2. Avatar for Formula350 22. Formula350 Lv 1 47 pts. 12,116
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 45 pts. 12,055
  4. Avatar for jausmh 24. jausmh Lv 1 44 pts. 12,040
  5. Avatar for Deleted player 25. Deleted player 42 pts. 12,036
  6. Avatar for KarenCH 26. KarenCH Lv 1 40 pts. 12,031
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 39 pts. 12,024
  8. Avatar for OWM3 28. OWM3 Lv 1 37 pts. 12,003
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 36 pts. 11,939
  10. Avatar for TastyMunchies 30. TastyMunchies Lv 1 34 pts. 11,925

Comments