Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for ucad 51. ucad Lv 1 13 pts. 11,502
  2. Avatar for robgee 52. robgee Lv 1 13 pts. 11,477
  3. Avatar for TheGUmmer 53. TheGUmmer Lv 1 12 pts. 11,470
  4. Avatar for martinzblavy 54. martinzblavy Lv 1 12 pts. 11,465
  5. Avatar for Enzyme 55. Enzyme Lv 1 11 pts. 11,465
  6. Avatar for CharlieFortsConscience 56. CharlieFortsConscience Lv 1 10 pts. 11,450
  7. Avatar for Pawel Tluscik 57. Pawel Tluscik Lv 1 10 pts. 11,441
  8. Avatar for phi16 58. phi16 Lv 1 9 pts. 11,419
  9. Avatar for borattt 59. borattt Lv 1 9 pts. 11,392
  10. Avatar for nicobul 60. nicobul Lv 1 9 pts. 11,357

Comments