Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for ucad 51. ucad Lv 1 13 pts. 11,502
  2. Avatar for robgee 52. robgee Lv 1 13 pts. 11,477
  3. Avatar for TheGUmmer 53. TheGUmmer Lv 1 12 pts. 11,470
  4. Avatar for martinzblavy 54. martinzblavy Lv 1 12 pts. 11,465
  5. Avatar for Enzyme 55. Enzyme Lv 1 11 pts. 11,465
  6. Avatar for CharlieFortsConscience 56. CharlieFortsConscience Lv 1 10 pts. 11,450
  7. Avatar for Pawel Tluscik 57. Pawel Tluscik Lv 1 10 pts. 11,441
  8. Avatar for phi16 58. phi16 Lv 1 9 pts. 11,419
  9. Avatar for borattt 59. borattt Lv 1 9 pts. 11,392
  10. Avatar for nicobul 60. nicobul Lv 1 9 pts. 11,357

Comments