Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for Trajan464 81. Trajan464 Lv 1 3 pts. 10,852
  2. Avatar for Mr.MAO 82. Mr.MAO Lv 1 2 pts. 10,812
  3. Avatar for Mohoernchen 83. Mohoernchen Lv 1 2 pts. 10,804
  4. Avatar for rinze 84. rinze Lv 1 2 pts. 10,803
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 2 pts. 10,800
  6. Avatar for bcre8tvv 86. bcre8tvv Lv 1 2 pts. 10,786
  7. Avatar for ivalnic 87. ivalnic Lv 1 2 pts. 10,783
  8. Avatar for CAN1958 88. CAN1958 Lv 1 2 pts. 10,768
  9. Avatar for hada 89. hada Lv 1 2 pts. 10,722
  10. Avatar for StarlightMouse 90. StarlightMouse Lv 1 2 pts. 10,722

Comments