Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for Trajan464 81. Trajan464 Lv 1 3 pts. 10,852
  2. Avatar for Mr.MAO 82. Mr.MAO Lv 1 2 pts. 10,812
  3. Avatar for Mohoernchen 83. Mohoernchen Lv 1 2 pts. 10,804
  4. Avatar for rinze 84. rinze Lv 1 2 pts. 10,803
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 2 pts. 10,800
  6. Avatar for bcre8tvv 86. bcre8tvv Lv 1 2 pts. 10,786
  7. Avatar for ivalnic 87. ivalnic Lv 1 2 pts. 10,783
  8. Avatar for CAN1958 88. CAN1958 Lv 1 2 pts. 10,768
  9. Avatar for hada 89. hada Lv 1 2 pts. 10,722
  10. Avatar for StarlightMouse 90. StarlightMouse Lv 1 2 pts. 10,722

Comments