Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for pandapharmd 91. pandapharmd Lv 1 1 pt. 10,713
  2. Avatar for fpc 92. fpc Lv 1 1 pt. 10,698
  3. Avatar for foobar23 93. foobar23 Lv 1 1 pt. 10,696
  4. Avatar for NPrincipi 94. NPrincipi Lv 1 1 pt. 10,685
  5. Avatar for BarrySampson 95. BarrySampson Lv 1 1 pt. 10,674
  6. Avatar for gldisater 96. gldisater Lv 1 1 pt. 10,665
  7. Avatar for ProfVince 97. ProfVince Lv 1 1 pt. 10,645
  8. Avatar for PieThrower 98. PieThrower Lv 1 1 pt. 10,643
  9. Avatar for rabamino12358 99. rabamino12358 Lv 1 1 pt. 10,635
  10. Avatar for manu8170 100. manu8170 Lv 1 1 pt. 10,601

Comments