Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for SEF830 141. SEF830 Lv 1 1 pt. 8,443
  2. Avatar for harvardman 142. harvardman Lv 1 1 pt. 8,415
  3. Avatar for Adenn-Skimu 143. Adenn-Skimu Lv 1 1 pt. 8,316
  4. Avatar for Piup 144. Piup Lv 1 1 pt. 8,091
  5. Avatar for Mr.MAO 145. Mr.MAO Lv 1 1 pt. 7,794
  6. Avatar for Taifun68 146. Taifun68 Lv 1 1 pt. 7,144
  7. Avatar for kryptoid256 147. kryptoid256 Lv 1 1 pt. 6,958
  8. Avatar for jflat06 148. jflat06 Lv 1 1 pt. 5,982
  9. Avatar for eraysim 149. eraysim Lv 1 1 pt. 5,423
  10. Avatar for Mike Lewis 150. Mike Lewis Lv 1 1 pt. 4,605

Comments