Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for Dr.Sillem 131. Dr.Sillem Lv 1 1 pt. 8,929
  2. Avatar for SaraL 132. SaraL Lv 1 1 pt. 8,927
  3. Avatar for jawz101 133. jawz101 Lv 1 1 pt. 8,851
  4. Avatar for JustinRothganger 134. JustinRothganger Lv 1 1 pt. 8,838
  5. Avatar for seowhang 135. seowhang Lv 1 1 pt. 8,820
  6. Avatar for hajtogato 136. hajtogato Lv 1 1 pt. 8,808
  7. Avatar for 3multid 137. 3multid Lv 1 1 pt. 8,791
  8. Avatar for takin 138. takin Lv 1 1 pt. 8,629
  9. Avatar for deathbat_87 139. deathbat_87 Lv 1 1 pt. 8,595
  10. Avatar for Gt54esd 140. Gt54esd Lv 1 1 pt. 8,535

Comments