Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for ivalnic 111. ivalnic Lv 1 1 pt. 9,599
  2. Avatar for neonrainbowtime 112. neonrainbowtime Lv 1 1 pt. 9,595
  3. Avatar for Czim 113. Czim Lv 1 1 pt. 9,546
  4. Avatar for vuvuvu 114. vuvuvu Lv 1 1 pt. 9,540
  5. Avatar for donuts554 115. donuts554 Lv 1 1 pt. 9,533
  6. Avatar for HuubR 116. HuubR Lv 1 1 pt. 9,531
  7. Avatar for Sadaharu06.jp 117. Sadaharu06.jp Lv 1 1 pt. 9,525
  8. Avatar for anton_rsol96 118. anton_rsol96 Lv 1 1 pt. 9,508
  9. Avatar for Hellcat6 119. Hellcat6 Lv 1 1 pt. 9,489
  10. Avatar for dahast.de 120. dahast.de Lv 1 1 pt. 9,469

Comments