Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for manu8170 31. manu8170 Lv 1 35 pts. 11,904
  2. Avatar for Vinara 32. Vinara Lv 1 34 pts. 11,863
  3. Avatar for Alistair69 33. Alistair69 Lv 1 32 pts. 11,842
  4. Avatar for WBarme1234 34. WBarme1234 Lv 1 31 pts. 11,835
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 30 pts. 11,779
  6. Avatar for BootsMcGraw 36. BootsMcGraw Lv 1 29 pts. 11,765
  7. Avatar for Norrjane 37. Norrjane Lv 1 28 pts. 11,747
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 27 pts. 11,724
  9. Avatar for Blipperman 39. Blipperman Lv 1 26 pts. 11,712
  10. Avatar for jausmh 40. jausmh Lv 1 24 pts. 11,646

Comments