Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 51 pts. 12,203
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 49 pts. 12,178
  3. Avatar for OWM3 23. OWM3 Lv 1 48 pts. 12,137
  4. Avatar for grogar7 24. grogar7 Lv 1 46 pts. 12,125
  5. Avatar for nicobul 25. nicobul Lv 1 44 pts. 12,115
  6. Avatar for jobo0502 26. jobo0502 Lv 1 43 pts. 12,095
  7. Avatar for aznarog 27. aznarog Lv 1 41 pts. 12,093
  8. Avatar for TastyMunchies 28. TastyMunchies Lv 1 39 pts. 12,091
  9. Avatar for RockOn 29. RockOn Lv 1 38 pts. 12,076
  10. Avatar for Deleted player 30. Deleted player 37 pts. 12,067

Comments