Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for xythus 111. xythus Lv 1 1 pt. 8,469
  2. Avatar for skovz99 112. skovz99 Lv 1 1 pt. 8,427
  3. Avatar for chris69300 113. chris69300 Lv 1 1 pt. 8,417
  4. Avatar for Dr.Sillem 114. Dr.Sillem Lv 1 1 pt. 8,402
  5. Avatar for Swapper242 115. Swapper242 Lv 1 1 pt. 8,392
  6. Avatar for reich64 116. reich64 Lv 1 1 pt. 8,381
  7. Avatar for bcdulay 117. bcdulay Lv 1 1 pt. 8,366
  8. Avatar for hajtogato 118. hajtogato Lv 1 1 pt. 8,357
  9. Avatar for wudoo 119. wudoo Lv 1 1 pt. 8,350
  10. Avatar for ivalnic 120. ivalnic Lv 1 1 pt. 8,345

Comments