Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups


  1. Avatar for Go Science 100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262

  1. Avatar for Todd6485577 91. Todd6485577 Lv 1 1 pt. 9,067
  2. Avatar for manu8170 92. manu8170 Lv 1 1 pt. 9,055
  3. Avatar for kyoota 93. kyoota Lv 1 1 pt. 8,984
  4. Avatar for matt61ger 94. matt61ger Lv 1 1 pt. 8,940
  5. Avatar for rabamino12358 95. rabamino12358 Lv 1 1 pt. 8,929
  6. Avatar for rinze 96. rinze Lv 1 1 pt. 8,880
  7. Avatar for fuxinyu 97. fuxinyu Lv 1 1 pt. 8,851
  8. Avatar for Bearpaw 98. Bearpaw Lv 1 1 pt. 8,801
  9. Avatar for Raguth Wolf 99. Raguth Wolf Lv 1 1 pt. 8,753
  10. Avatar for fearjuan 100. fearjuan Lv 1 1 pt. 8,739

Comments