Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for Evica 81. Evica Lv 1 2 pts. 9,415
  2. Avatar for Philzord 82. Philzord Lv 1 2 pts. 9,341
  3. Avatar for jsfoldingaccount 83. jsfoldingaccount Lv 1 2 pts. 9,328
  4. Avatar for ShadowTactics 84. ShadowTactics Lv 1 2 pts. 9,311
  5. Avatar for CAN1958 85. CAN1958 Lv 1 2 pts. 9,291
  6. Avatar for Trajan464 86. Trajan464 Lv 1 2 pts. 9,272
  7. Avatar for GuR0 87. GuR0 Lv 1 2 pts. 9,221
  8. Avatar for crowns 88. crowns Lv 1 1 pt. 9,107
  9. Avatar for fishercat 89. fishercat Lv 1 1 pt. 9,091
  10. Avatar for dldahlen 90. dldahlen Lv 1 1 pt. 9,077

Comments